Ganoderic acid N

CAS No. 110241-19-5

Ganoderic acid N( —— )

Catalog No. M31126 CAS No. 110241-19-5

23-Dihydroganoderic Acid N has anticancer effects.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 342 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    Ganoderic acid N
  • Note
    Research use only, not for human use.
  • Brief Description
    23-Dihydroganoderic Acid N has anticancer effects.
  • Description
    23-Dihydroganoderic Acid N has anticancer effects.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    110241-19-5
  • Formula Weight
    530.65
  • Molecular Formula
    C30H42O8
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 50 mg/mL (94.22 mM)
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • AH 6696

    AH 6696 is a biochemical.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Laquinimod

    Laquinimod (ABR-215062) is an immunoregulator derived from Linomide, has been shown to completely inhibit the development of murine acute experimental autoimmune encephalomyelitis (EAE).